PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013599523.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 258aa    MW: 29435.9 Da    PI: 7.9097
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013599523.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.81.4e-141966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l   v ++G  +W+tI+   g+ R +k+c++rw +yl
   XP_013599523.1 19 KGLWSPEEDEKLRSHVLKYGHVCWSTIPIQAGLQRNGKSCRLRWVNYL 66
                     678*****************99************************97 PP

2Myb_DNA-binding51.91.7e-1672117148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      + ++T+eE+  l+ ++  lG++ W+ I+++++ gRt++++k++w++yl
   XP_013599523.1  72 KSAFTKEEETTLLSLHSILGNK-WAHISKYLP-GRTDNEIKNYWHSYL 117
                      578*******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6411466IPR017930Myb domain
SuperFamilySSF466893.52E-2916113IPR009057Homeodomain-like
SMARTSM007177.6E-111868IPR001005SANT/Myb domain
PfamPF002491.9E-121966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-222073IPR009057Homeodomain-like
CDDcd001671.63E-92266No hitNo description
PROSITE profilePS5129425.37367121IPR017930Myb domain
SMARTSM007178.3E-1671119IPR001005SANT/Myb domain
PfamPF002491.9E-1572117IPR001005SANT/Myb domain
CDDcd001671.17E-1174117No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2474121IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MVCKSETSNR KLNKVRQRKG LWSPEEDEKL RSHVLKYGHV CWSTIPIQAG LQRNGKSCRL  60
RWVNYLRPGL KKSAFTKEEE TTLLSLHSIL GNKWAHISKY LPGRTDNEIK NYWHSYLKKS  120
VVPSRKDETT RTPQTHSVAN SLEAFESTSE RSSSCSNFGD SFRAKVSNFS PSLVFSEWLD  180
DSLVMDQSPQ KYSYVQDHIV PQQSGFVETF SQGFYENNNS LDNFIPNSGF SLEGDIEFCT  240
SFSDSFLVDA LVSEQGSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27191217108B-MYB
1h8a_C9e-271912127128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013599523.10.0PREDICTED: transcription factor LAF1 isoform X1
SwissprotQ9M0K44e-61LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A0D3DRH70.0A0A0D3DRH7_BRAOL; Uncharacterized protein
STRINGBra018027.1-P1e-149(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48920.11e-117myb domain protein 45